Fibrinogen beta chain/FGB Antibody orb389404 from Biorbyt

Product Specs
ItemFibrinogen beta chain/FGB Antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb389404
Quantity10 µg, 100 µg
ApplicationsFC, ICC, IF, WB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Mouse, Rat
TargetFibrinogen beta chain/FGB
IsotypeRabbit IgG
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids
NCBI Full Gene Namefibrinogen beta chain
NCBI Gene AliasesHEL-S-78p
ClonalityPolyclonal
Molecular Weight55928 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 5 µg/ml, Human Flow Cytometry, 1-3µg/1x106 cells, Human

Add to Compare List